PAX7 monoclonal antibody (M05), clone 1E12
  • PAX7 monoclonal antibody (M05), clone 1E12

PAX7 monoclonal antibody (M05), clone 1E12

Ref: AB-H00005081-M05
PAX7 monoclonal antibody (M05), clone 1E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAX7.
Información adicional
Size 100 ug
Gene Name PAX7
Gene Alias HUP1|PAX7B
Gene Description paired box 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5081
Clone Number 1E12
Iso type IgG2a Kappa

Enviar uma mensagem


PAX7 monoclonal antibody (M05), clone 1E12

PAX7 monoclonal antibody (M05), clone 1E12