PAX5 purified MaxPab rabbit polyclonal antibody (D01P)
  • PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005079-D01P
PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAX5 protein.
Información adicional
Size 100 ug
Gene Name PAX5
Gene Alias BSAP
Gene Description paired box 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAX5 (NP_057953.1, 1 a.a. ~ 391 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5079

Enviar uma mensagem


PAX5 purified MaxPab rabbit polyclonal antibody (D01P)

PAX5 purified MaxPab rabbit polyclonal antibody (D01P)