PAX4 polyclonal antibody (A01)
  • PAX4 polyclonal antibody (A01)

PAX4 polyclonal antibody (A01)

Ref: AB-H00005078-A01
PAX4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAX4.
Información adicional
Size 50 uL
Gene Name PAX4
Gene Alias KPD|MGC129960|MODY9
Gene Description paired box 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX4 (NP_006184, 121 a.a. ~ 217 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5078

Enviar uma mensagem


PAX4 polyclonal antibody (A01)

PAX4 polyclonal antibody (A01)