PAX3 purified MaxPab rabbit polyclonal antibody (D01P)
  • PAX3 purified MaxPab rabbit polyclonal antibody (D01P)

PAX3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005077-D01P
PAX3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PAX3 protein.
Información adicional
Size 100 ug
Gene Name PAX3
Gene Alias CDHS|HUP2|MGC120381|MGC120382|MGC120383|MGC120384|MGC134778|WS1
Gene Description paired box 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAX3 (NP_852123.1, 1 a.a. ~ 484 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5077

Enviar uma mensagem


PAX3 purified MaxPab rabbit polyclonal antibody (D01P)

PAX3 purified MaxPab rabbit polyclonal antibody (D01P)