PAX3 polyclonal antibody (A01)
  • PAX3 polyclonal antibody (A01)

PAX3 polyclonal antibody (A01)

Ref: AB-H00005077-A01
PAX3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAX3.
Información adicional
Size 50 uL
Gene Name PAX3
Gene Alias CDHS|HUP2|MGC120381|MGC120382|MGC120383|MGC120384|MGC134778|WS1
Gene Description paired box 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPSVSSISRILRSKFGKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX3 (NP_000429, 84 a.a. ~ 165 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5077

Enviar uma mensagem


PAX3 polyclonal antibody (A01)

PAX3 polyclonal antibody (A01)