PAX2 monoclonal antibody (M01), clone 3C7
  • PAX2 monoclonal antibody (M01), clone 3C7

PAX2 monoclonal antibody (M01), clone 3C7

Ref: AB-H00005076-M01
PAX2 monoclonal antibody (M01), clone 3C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PAX2.
Información adicional
Size 100 ug
Gene Name PAX2
Gene Alias -
Gene Description paired box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5076
Clone Number 3C7
Iso type IgG2a Kappa

Enviar uma mensagem


PAX2 monoclonal antibody (M01), clone 3C7

PAX2 monoclonal antibody (M01), clone 3C7