PAX2 polyclonal antibody (A01)
  • PAX2 polyclonal antibody (A01)

PAX2 polyclonal antibody (A01)

Ref: AB-H00005076-A01
PAX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PAX2.
Información adicional
Size 50 uL
Gene Name PAX2
Gene Alias -
Gene Description paired box 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PAX2 (NP_000269, 194 a.a. ~ 303 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5076

Enviar uma mensagem


PAX2 polyclonal antibody (A01)

PAX2 polyclonal antibody (A01)