PALM polyclonal antibody (A01)
  • PALM polyclonal antibody (A01)

PALM polyclonal antibody (A01)

Ref: AB-H00005064-A01
PALM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PALM.
Información adicional
Size 50 uL
Gene Name PALM
Gene Alias KIAA0270
Gene Description paralemmin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VEKDKVTGETRVLSSTTLLPRQPLPLGIKVYEDETKVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAAETRGAVEGAARTTPSRREITGVQAQPGEAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PALM (NP_005839, 176 a.a. ~ 284 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5064

Enviar uma mensagem


PALM polyclonal antibody (A01)

PALM polyclonal antibody (A01)