PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)
  • PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)

PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005050-B01P
PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PAFAH1B3 protein.
Información adicional
Size 50 ug
Gene Name PAFAH1B3
Gene Alias -
Gene Description platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGAPLLEPAP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PAFAH1B3 (NP_002564.1, 1 a.a. ~ 231 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5050

Enviar uma mensagem


PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)

PAFAH1B3 purified MaxPab mouse polyclonal antibody (B01P)