PCSK6 monoclonal antibody (M01), clone 2D6
  • PCSK6 monoclonal antibody (M01), clone 2D6

PCSK6 monoclonal antibody (M01), clone 2D6

Ref: AB-H00005046-M01
PCSK6 monoclonal antibody (M01), clone 2D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCSK6.
Información adicional
Size 100 ug
Gene Name PCSK6
Gene Alias PACE4|SPC4
Gene Description proprotein convertase subtilisin/kexin type 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCSK6 (NP_002561, 860 a.a. ~ 969 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5046
Clone Number 2D6
Iso type IgG2a Kappa

Enviar uma mensagem


PCSK6 monoclonal antibody (M01), clone 2D6

PCSK6 monoclonal antibody (M01), clone 2D6