PCSK6 polyclonal antibody (A01)
  • PCSK6 polyclonal antibody (A01)

PCSK6 polyclonal antibody (A01)

Ref: AB-H00005046-A01
PCSK6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PCSK6.
Información adicional
Size 50 uL
Gene Name PCSK6
Gene Alias PACE4|SPC4
Gene Description proprotein convertase subtilisin/kexin type 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCSK6 (NP_002561, 860 a.a. ~ 969 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5046

Enviar uma mensagem


PCSK6 polyclonal antibody (A01)

PCSK6 polyclonal antibody (A01)