PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)

PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005036-D01P
PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PA2G4 protein.
Información adicional
Size 100 ug
Gene Name PA2G4
Gene Alias EBP1|HG4-1|p38-2G4
Gene Description proliferation-associated 2G4, 38kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PA2G4 (NP_006182.2, 1 a.a. ~ 394 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5036

Enviar uma mensagem


PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)

PA2G4 purified MaxPab rabbit polyclonal antibody (D01P)