P2RY1 monoclonal antibody (M01), clone 4C2
  • P2RY1 monoclonal antibody (M01), clone 4C2

P2RY1 monoclonal antibody (M01), clone 4C2

Ref: AB-H00005028-M01
P2RY1 monoclonal antibody (M01), clone 4C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant P2RY1.
Información adicional
Size 50 ug
Gene Name P2RY1
Gene Alias P2Y1
Gene Description purinergic receptor P2Y, G-protein coupled, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTEVLWPAVPNGTDAAFLAGPGSSWGNSTVASTAAVSSSFKCALTKTGFQFY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen P2RY1 (NP_002554, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5028
Clone Number 4C2
Iso type IgG2a Kappa

Enviar uma mensagem


P2RY1 monoclonal antibody (M01), clone 4C2

P2RY1 monoclonal antibody (M01), clone 4C2