P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)
  • P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005025-D01P
P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human P2RX4 protein.
Información adicional
Size 100 ug
Gene Name P2RX4
Gene Alias P2X4|P2X4R
Gene Description purinergic receptor P2X, ligand-gated ion channel, 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen P2RX4 (NP_002551.2, 1 a.a. ~ 388 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5025

Enviar uma mensagem


P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX4 purified MaxPab rabbit polyclonal antibody (D01P)