P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005023-D01P
P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human P2RX1 protein.
Información adicional
Size 100 ug
Gene Name P2RX1
Gene Alias P2X1
Gene Description purinergic receptor P2X, ligand-gated ion channel, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLKGLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRKAQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen P2RX1 (NP_002549.1, 1 a.a. ~ 399 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5023

Enviar uma mensagem


P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)

P2RX1 purified MaxPab rabbit polyclonal antibody (D01P)