OSM purified MaxPab rabbit polyclonal antibody (D01P)
  • OSM purified MaxPab rabbit polyclonal antibody (D01P)

OSM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005008-D01P
OSM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OSM protein.
Información adicional
Size 100 ug
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSM (NP_065391.1, 1 a.a. ~ 252 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5008

Enviar uma mensagem


OSM purified MaxPab rabbit polyclonal antibody (D01P)

OSM purified MaxPab rabbit polyclonal antibody (D01P)