ORM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ORM1 purified MaxPab rabbit polyclonal antibody (D01P)

ORM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005004-D01P
ORM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ORM1 protein.
Información adicional
Size 100 ug
Gene Name ORM1
Gene Alias AGP-A|AGP1|ORM
Gene Description orosomucoid 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ORM1 (NP_000598.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5004

Enviar uma mensagem


ORM1 purified MaxPab rabbit polyclonal antibody (D01P)

ORM1 purified MaxPab rabbit polyclonal antibody (D01P)