ORC4L monoclonal antibody (M05), clone 2A8
  • ORC4L monoclonal antibody (M05), clone 2A8

ORC4L monoclonal antibody (M05), clone 2A8

Ref: AB-H00005000-M05
ORC4L monoclonal antibody (M05), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ORC4L.
Información adicional
Size 100 ug
Gene Name ORC4L
Gene Alias ORC4|ORC4P
Gene Description origin recognition complex, subunit 4-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLISHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ORC4L (AAH05388, 1 a.a. ~ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5000
Clone Number 2A8
Iso type IgG2b Kappa

Enviar uma mensagem


ORC4L monoclonal antibody (M05), clone 2A8

ORC4L monoclonal antibody (M05), clone 2A8