ORC4L purified MaxPab rabbit polyclonal antibody (D01P)
  • ORC4L purified MaxPab rabbit polyclonal antibody (D01P)

ORC4L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005000-D01P
ORC4L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ORC4L protein.
Información adicional
Size 100 ug
Gene Name ORC4L
Gene Alias ORC4|ORC4P
Gene Description origin recognition complex, subunit 4-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ORC4L (NP_002543.2, 1 a.a. ~ 436 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5000

Enviar uma mensagem


ORC4L purified MaxPab rabbit polyclonal antibody (D01P)

ORC4L purified MaxPab rabbit polyclonal antibody (D01P)