ORC1L polyclonal antibody (A01)
  • ORC1L polyclonal antibody (A01)

ORC1L polyclonal antibody (A01)

Ref: AB-H00004998-A01
ORC1L polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ORC1L.
Información adicional
Size 50 uL
Gene Name ORC1L
Gene Alias HSORC1|ORC1|PARC1
Gene Description origin recognition complex, subunit 1-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAHYPTRLKTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIGQFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKRHLLGRKPGAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ORC1L (AAH11539, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4998

Enviar uma mensagem


ORC1L polyclonal antibody (A01)

ORC1L polyclonal antibody (A01)