OPRL1 monoclonal antibody (M02), clone 2A11
  • OPRL1 monoclonal antibody (M02), clone 2A11

OPRL1 monoclonal antibody (M02), clone 2A11

Ref: AB-H00004987-M02
OPRL1 monoclonal antibody (M02), clone 2A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OPRL1.
Información adicional
Size 100 ug
Gene Name OPRL1
Gene Alias KOR-3|MGC34578|NOCIR|OOR|ORL1
Gene Description opiate receptor-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OPRL1 (AAH38433, 110 a.a. ~ 212 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4987
Clone Number 2A11
Iso type IgG2a Kappa

Enviar uma mensagem


OPRL1 monoclonal antibody (M02), clone 2A11

OPRL1 monoclonal antibody (M02), clone 2A11