OPRK1 polyclonal antibody (A01)
  • OPRK1 polyclonal antibody (A01)

OPRK1 polyclonal antibody (A01)

Ref: AB-H00004986-A01
OPRK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant OPRK1.
Información adicional
Size 50 uL
Gene Name OPRK1
Gene Alias KOR|OPRK
Gene Description opioid receptor, kappa 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OPRK1 (NP_000903, 1 a.a. ~ 58 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4986

Enviar uma mensagem


OPRK1 polyclonal antibody (A01)

OPRK1 polyclonal antibody (A01)