TNFRSF11B MaxPab rabbit polyclonal antibody (D01)
  • TNFRSF11B MaxPab rabbit polyclonal antibody (D01)

TNFRSF11B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004982-D01
TNFRSF11B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TNFRSF11B protein.
Información adicional
Size 100 uL
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF11B (AAH30155.1, 1 a.a. ~ 401 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4982

Enviar uma mensagem


TNFRSF11B MaxPab rabbit polyclonal antibody (D01)

TNFRSF11B MaxPab rabbit polyclonal antibody (D01)