TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)
  • TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)

TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00004982-B02P
TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFRSF11B protein.
Información adicional
Size 50 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFRSF11B (AAH30155.1, 1 a.a. ~ 401 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4982

Enviar uma mensagem


TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)

TNFRSF11B purified MaxPab mouse polyclonal antibody (B02P)