OMP monoclonal antibody (M01), clone 2B7
  • OMP monoclonal antibody (M01), clone 2B7

OMP monoclonal antibody (M01), clone 2B7

Ref: AB-H00004975-M01
OMP monoclonal antibody (M01), clone 2B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OMP.
Información adicional
Size 100 ug
Gene Name OMP
Gene Alias -
Gene Description olfactory marker protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OMP (NP_006180.1, 65 a.a. ~ 163 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4975
Clone Number 2B7
Iso type IgG2a Kappa

Enviar uma mensagem


OMP monoclonal antibody (M01), clone 2B7

OMP monoclonal antibody (M01), clone 2B7