OGN MaxPab rabbit polyclonal antibody (D01)
  • OGN MaxPab rabbit polyclonal antibody (D01)

OGN MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004969-D01
OGN MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OGN protein.
Información adicional
Size 100 uL
Gene Name OGN
Gene Alias DKFZp586P2421|OG|OIF|SLRR3A
Gene Description osteoglycin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKSLQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OGN (AAH37273.1, 1 a.a. ~ 298 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4969

Enviar uma mensagem


OGN MaxPab rabbit polyclonal antibody (D01)

OGN MaxPab rabbit polyclonal antibody (D01)