OMD purified MaxPab rabbit polyclonal antibody (D01P)
  • OMD purified MaxPab rabbit polyclonal antibody (D01P)

OMD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004958-D01P
OMD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OMD protein.
Información adicional
Size 100 ug
Gene Name OMD
Gene Alias OSAD|SLRR2C
Gene Description osteomodulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OMD (NP_005005.1, 1 a.a. ~ 421 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4958

Enviar uma mensagem


OMD purified MaxPab rabbit polyclonal antibody (D01P)

OMD purified MaxPab rabbit polyclonal antibody (D01P)