OAT purified MaxPab rabbit polyclonal antibody (D01P)
  • OAT purified MaxPab rabbit polyclonal antibody (D01P)

OAT purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004942-D01P
OAT purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human OAT protein.
Información adicional
Size 100 ug
Gene Name OAT
Gene Alias DKFZp781A11155|HOGA
Gene Description ornithine aminotransferase (gyrate atrophy)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFSKLAHFQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OAT (NP_000265.1, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4942

Enviar uma mensagem


OAT purified MaxPab rabbit polyclonal antibody (D01P)

OAT purified MaxPab rabbit polyclonal antibody (D01P)