NR4A2 monoclonal antibody (M13), clone 2A3
  • NR4A2 monoclonal antibody (M13), clone 2A3

NR4A2 monoclonal antibody (M13), clone 2A3

Ref: AB-H00004929-M13
NR4A2 monoclonal antibody (M13), clone 2A3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NR4A2.
Información adicional
Size 100 ug
Gene Name NR4A2
Gene Alias HZF-3|NOT|NURR1|RNR1|TINUR
Gene Description nuclear receptor subfamily 4, group A, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq GSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPS*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NR4A2 (NP_006177, 147 a.a. ~ 250 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4929
Clone Number 2A3
Iso type IgG2b Kappa

Enviar uma mensagem


NR4A2 monoclonal antibody (M13), clone 2A3

NR4A2 monoclonal antibody (M13), clone 2A3