NUP98 monoclonal antibody (M01), clone 4G2
  • NUP98 monoclonal antibody (M01), clone 4G2

NUP98 monoclonal antibody (M01), clone 4G2

Ref: AB-H00004928-M01
NUP98 monoclonal antibody (M01), clone 4G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUP98.
Información adicional
Size 100 ug
Gene Name NUP98
Gene Alias ADIR2|NUP196|NUP96
Gene Description nucleoporin 98kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUP98 (AAH12906.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4928
Clone Number 4G2
Iso type IgG2a Kappa

Enviar uma mensagem


NUP98 monoclonal antibody (M01), clone 4G2

NUP98 monoclonal antibody (M01), clone 4G2