NUP98 MaxPab rabbit polyclonal antibody (D01)
  • NUP98 MaxPab rabbit polyclonal antibody (D01)

NUP98 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004928-D01
NUP98 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NUP98 protein.
Información adicional
Size 100 uL
Gene Name NUP98
Gene Alias ADIR2|NUP196|NUP96
Gene Description nucleoporin 98kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUP98 (AAH12906.1, 1 a.a. ~ 606 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4928

Enviar uma mensagem


NUP98 MaxPab rabbit polyclonal antibody (D01)

NUP98 MaxPab rabbit polyclonal antibody (D01)