NUP98 MaxPab mouse polyclonal antibody (B02)
  • NUP98 MaxPab mouse polyclonal antibody (B02)

NUP98 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00004928-B02
NUP98 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human NUP98 protein.
Información adicional
Size 50 uL
Gene Name NUP98
Gene Alias ADIR2|NUP196|NUP96
Gene Description nucleoporin 98kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEEVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLVDWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTASISRALSMYEEAFQNTSDSDRYACSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUP98 (AAH12906.1, 1 a.a. ~ 606 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4928

Enviar uma mensagem


NUP98 MaxPab mouse polyclonal antibody (B02)

NUP98 MaxPab mouse polyclonal antibody (B02)