NUP98 polyclonal antibody (A01)
  • NUP98 polyclonal antibody (A01)

NUP98 polyclonal antibody (A01)

Ref: AB-H00004928-A01
NUP98 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NUP98.
Información adicional
Size 50 uL
Gene Name NUP98
Gene Alias ADIR2|NUP196|NUP96
Gene Description nucleoporin 98kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDLPEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUP98 (AAH12906.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4928

Enviar uma mensagem


NUP98 polyclonal antibody (A01)

NUP98 polyclonal antibody (A01)