NTS purified MaxPab rabbit polyclonal antibody (D01P)
  • NTS purified MaxPab rabbit polyclonal antibody (D01P)

NTS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004922-D01P
NTS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NTS protein.
Información adicional
Size 100 ug
Gene Name NTS
Gene Alias NMN-125|NN|NT|NT/N|NTS1
Gene Description neurotensin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NTS (NP_006174.1, 1 a.a. ~ 170 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4922

Enviar uma mensagem


NTS purified MaxPab rabbit polyclonal antibody (D01P)

NTS purified MaxPab rabbit polyclonal antibody (D01P)