DDR2 polyclonal antibody (A01)
  • DDR2 polyclonal antibody (A01)

DDR2 polyclonal antibody (A01)

Ref: AB-H00004921-A01
DDR2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DDR2.
Información adicional
Size 50 uL
Gene Name DDR2
Gene Alias MIG20a|NTRKR3|TKT|TYRO10
Gene Description discoidin domain receptor tyrosine kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEAL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DDR2 (AAH52998, 277 a.a. ~ 377 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4921

Enviar uma mensagem


DDR2 polyclonal antibody (A01)

DDR2 polyclonal antibody (A01)