ROR2 monoclonal antibody (M04), clone 4B8
  • ROR2 monoclonal antibody (M04), clone 4B8

ROR2 monoclonal antibody (M04), clone 4B8

Ref: AB-H00004920-M04
ROR2 monoclonal antibody (M04), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ROR2.
Información adicional
Size 100 ug
Gene Name ROR2
Gene Alias BDB|BDB1|MGC163394|NTRKR2
Gene Description receptor tyrosine kinase-like orphan receptor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq EVEVLDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ROR2 (NP_004551, 34 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4920
Clone Number 4B8
Iso type IgG2b Kappa

Enviar uma mensagem


ROR2 monoclonal antibody (M04), clone 4B8

ROR2 monoclonal antibody (M04), clone 4B8