NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)

NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004916-D01P
NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NTRK3 protein.
Información adicional
Size 100 ug
Gene Name NTRK3
Gene Alias TRKC|gp145(trkC)
Gene Description neurotrophic tyrosine kinase, receptor, type 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NTRK3 (NP_001007157.1, 1 a.a. ~ 612 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4916

Enviar uma mensagem


NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)

NTRK3 purified MaxPab rabbit polyclonal antibody (D01P)