NRCAM purified MaxPab rabbit polyclonal antibody (D01P)
  • NRCAM purified MaxPab rabbit polyclonal antibody (D01P)

NRCAM purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004897-D01P
NRCAM purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NRCAM protein.
Información adicional
Size 100 ug
Gene Name NRCAM
Gene Alias KIAA0343|MGC138845|MGC138846
Gene Description neuronal cell adhesion molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQLKIMPKKKRLSAGRVPLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NRCAM (AAH98401.1, 1 a.a. ~ 771 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4897

Enviar uma mensagem


NRCAM purified MaxPab rabbit polyclonal antibody (D01P)

NRCAM purified MaxPab rabbit polyclonal antibody (D01P)