NRAS polyclonal antibody (A01)
  • NRAS polyclonal antibody (A01)

NRAS polyclonal antibody (A01)

Ref: AB-H00004893-A01
NRAS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NRAS.
Información adicional
Size 50 uL
Gene Name NRAS
Gene Alias ALPS4|N-ras|NRAS1
Gene Description neuroblastoma RAS viral (v-ras) oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRAS (AAH05219, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4893

Enviar uma mensagem


NRAS polyclonal antibody (A01)

NRAS polyclonal antibody (A01)