NRAP monoclonal antibody (M01), clone 1E9
  • NRAP monoclonal antibody (M01), clone 1E9

NRAP monoclonal antibody (M01), clone 1E9

Ref: AB-H00004892-M01
NRAP monoclonal antibody (M01), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NRAP.
Información adicional
Size 100 ug
Gene Name NRAP
Gene Alias -
Gene Description nebulin-related anchoring protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LRHAQKAHQLQSDVKYKSDLNLTRGVGWTPPGSYKVEMARRAAELANARGLGLQGAYRGAEAVEAGDHQSGEVNPDATEILHVKKKKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRAP (NP_932326.2, 1640 a.a. ~ 1727 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4892
Clone Number 1E9
Iso type IgG2a Kappa

Enviar uma mensagem


NRAP monoclonal antibody (M01), clone 1E9

NRAP monoclonal antibody (M01), clone 1E9