NPHS1 monoclonal antibody (M02), clone 3H6
  • NPHS1 monoclonal antibody (M02), clone 3H6

NPHS1 monoclonal antibody (M02), clone 3H6

Ref: AB-H00004868-M02
NPHS1 monoclonal antibody (M02), clone 3H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPHS1.
Información adicional
Size 100 ug
Gene Name NPHS1
Gene Alias CNF|NPHN
Gene Description nephrosis 1, congenital, Finnish type (nephrin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPHS1 (NP_004637.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4868
Clone Number 3H6
Iso type IgG1 Kappa

Enviar uma mensagem


NPHS1 monoclonal antibody (M02), clone 3H6

NPHS1 monoclonal antibody (M02), clone 3H6