NPHP1 MaxPab mouse polyclonal antibody (B01)
  • NPHP1 MaxPab mouse polyclonal antibody (B01)

NPHP1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00004867-B01
NPHP1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human NPHP1 protein.
Información adicional
Size 50 uL
Gene Name NPHP1
Gene Alias FLJ97602|JBTS4|NPH1|SLSN1
Gene Description nephronophthisis 1 (juvenile)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLARRQRDPLQALRRRNQELKQQVDSLLSESQLKEALEPNKRQHIYQRCIQLKQAIDENKNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRENITEYASFLPFFFLF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NPHP1 (NP_997064.1, 1 a.a. ~ 121 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4867

Enviar uma mensagem


NPHP1 MaxPab mouse polyclonal antibody (B01)

NPHP1 MaxPab mouse polyclonal antibody (B01)