NP polyclonal antibody (A01)
  • NP polyclonal antibody (A01)

NP polyclonal antibody (A01)

Ref: AB-H00004860-A01
NP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NP.
Información adicional
Size 50 uL
Gene Name NP
Gene Alias FLJ94043|FLJ97288|FLJ97312|MGC117396|MGC125915|MGC125916|PNP|PRO1837|PUNP
Gene Description nucleoside phosphorylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NP (NP_000261, 174 a.a. ~ 283 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4860

Enviar uma mensagem


NP polyclonal antibody (A01)

NP polyclonal antibody (A01)