NOVA1 polyclonal antibody (A01)
  • NOVA1 polyclonal antibody (A01)

NOVA1 polyclonal antibody (A01)

Ref: AB-H00004857-A01
NOVA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NOVA1.
Información adicional
Size 50 uL
Gene Name NOVA1
Gene Alias Nova-1
Gene Description neuro-oncological ventral antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOVA1 (NP_002506, 408 a.a. ~ 507 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4857

Enviar uma mensagem


NOVA1 polyclonal antibody (A01)

NOVA1 polyclonal antibody (A01)