NOV MaxPab rabbit polyclonal antibody (D01)
  • NOV MaxPab rabbit polyclonal antibody (D01)

NOV MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004856-D01
NOV MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NOV protein.
Información adicional
Size 100 uL
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOV (AAH15028.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4856

Enviar uma mensagem


NOV MaxPab rabbit polyclonal antibody (D01)

NOV MaxPab rabbit polyclonal antibody (D01)