NOV purified MaxPab mouse polyclonal antibody (B01P)
  • NOV purified MaxPab mouse polyclonal antibody (B01P)

NOV purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004856-B01P
NOV purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NOV protein.
Información adicional
Size 50 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NOV (AAH15028.1, 1 a.a. ~ 357 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4856

Enviar uma mensagem


NOV purified MaxPab mouse polyclonal antibody (B01P)

NOV purified MaxPab mouse polyclonal antibody (B01P)