NPY monoclonal antibody (M02), clone 2C10
  • NPY monoclonal antibody (M02), clone 2C10

NPY monoclonal antibody (M02), clone 2C10

Ref: AB-H00004852-M02
NPY monoclonal antibody (M02), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NPY.
Información adicional
Size 100 ug
Gene Name NPY
Gene Alias PYY4
Gene Description neuropeptide Y
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NPY (AAH29497, 29 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4852
Clone Number 2C10
Iso type IgG1 Kappa

Enviar uma mensagem


NPY monoclonal antibody (M02), clone 2C10

NPY monoclonal antibody (M02), clone 2C10