NOTCH1 monoclonal antibody (M10), clone 4G1
  • NOTCH1 monoclonal antibody (M10), clone 4G1

NOTCH1 monoclonal antibody (M10), clone 4G1

Ref: AB-H00004851-M10
NOTCH1 monoclonal antibody (M10), clone 4G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOTCH1.
Información adicional
Size 100 ug
Gene Name NOTCH1
Gene Alias TAN1|hN1
Gene Description Notch homolog 1, translocation-associated (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq RCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOTCH1 (NP_060087, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4851
Clone Number 4G1
Iso type IgG1 Kappa

Enviar uma mensagem


NOTCH1 monoclonal antibody (M10), clone 4G1

NOTCH1 monoclonal antibody (M10), clone 4G1