CNOT3 monoclonal antibody (M01), clone 4B8
  • CNOT3 monoclonal antibody (M01), clone 4B8

CNOT3 monoclonal antibody (M01), clone 4B8

Ref: AB-H00004849-M01
CNOT3 monoclonal antibody (M01), clone 4B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNOT3.
Información adicional
Size 100 ug
Gene Name CNOT3
Gene Alias KIAA0691|LENG2|NOT3|NOT3H
Gene Description CCR4-NOT transcription complex, subunit 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT3 (NP_055331, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4849
Clone Number 4B8
Iso type IgG1 Kappa

Enviar uma mensagem


CNOT3 monoclonal antibody (M01), clone 4B8

CNOT3 monoclonal antibody (M01), clone 4B8