CNOT2 monoclonal antibody (M08), clone 3F1
  • CNOT2 monoclonal antibody (M08), clone 3F1

CNOT2 monoclonal antibody (M08), clone 3F1

Ref: AB-H00004848-M08
CNOT2 monoclonal antibody (M08), clone 3F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CNOT2.
Información adicional
Size 50 ug
Gene Name CNOT2
Gene Alias CDC36|HSPC131|NOT2|NOT2H
Gene Description CCR4-NOT transcription complex, subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT2 (NP_055330, 441 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4848
Clone Number 3F1
Iso type IgG2a Kappa

Enviar uma mensagem


CNOT2 monoclonal antibody (M08), clone 3F1

CNOT2 monoclonal antibody (M08), clone 3F1